PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00000g60665.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 244aa    MW: 27766.6 Da    PI: 6.8033
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00000g60665.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.22.1e-2495149155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k rl+Wt+eLHe Fv+ v++LGG+ +A Pk+i++ mk + ++l+h+kSHLQkYR 
  Peaxi162Scf00000g60665.1  95 KHRLKWTEELHEMFVNIVDELGGAWVAKPKAIKRKMKDDNISLYHIKSHLQKYRC 149
                               68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-2195149IPR009057Homeodomain-like
SuperFamilySSF466895.73E-1295149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2095149IPR006447Myb domain, plants
PfamPF002492.2E-797148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MFPLLPSANN ENFQVQNNDL LNRRFYQQPI LQPLQRNHEP LNDIPSLANY QPPRFLGGLN  60
LMNNNIINPP ALINFNFPRV DQLLNDVGST SQGIKHRLKW TEELHEMFVN IVDELGGAWV  120
AKPKAIKRKM KDDNISLYHI KSHLQKYRCG KAPNDVGGKN STRHLAVHVK QKKLLQEIEE  180
QMNEAAEKNV QKLESLEDQA SSSNMPITAS TPHVVAPEIG NMDSLEHVSK NDMEEFLSLL  240
ELPP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1533858
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-18G2-like family protein